Abstract
Transcriptome diversity in adult neurons is partly mediated by RNA binding proteins (RBPs), including the RBFOX factors. RBFOX3/NeuN, a neuronal maturity marker, is strangely depleted in suprachiasmatic nucleus (SCN) neurons, and may be compensated by a change in Rbfox2 expression. In this study, we found no superficial changes in Rbfox2 expression in the SCN, but mRNA population analysis revealed a distinct SCN transcript profile that includes multiple novel Rbfox2 isoforms. Of eleven isoforms in SCN and cerebral cortex that exhibit exon variation across two protein domains, we found a 3-fold higher abundance of a novel (‘−12–40’) C-terminal domain (CTD)-variant in the SCN. This isoform embraces an alternative reading frame that imparts a 50% change in CTD protein sequence, and functional impairment of exon 7 exclusion activity in a RBFOX2-target, the L-type calcium channel gene, Cacna1c. We have also demonstrated functional correlates in SCN gene transcripts; inclusion of Cacna1c exon 7, and also exclusion of both NMDA receptor gene Grin1 exon 4, and Enah exon 12, all consistent with a change in SCN RBFOX activity. The demonstrated regional diversity of Rbfox2 in adult brain highlights the functional adaptability of this RBP, enabling neuronal specialization, and potentially responding to disease-related neuronal dysfunction.
Similar content being viewed by others
Introduction
Alternative gene splicing is a major determinant of neuron-specific function1, affecting both individual proteins, and ultimately, protein interaction networks2. Multiple factors contribute to alternative splicing, and of these, RNA binding proteins (RBPs) are known to be important determinants of cell-specific splicing3. In neurons, one family of RBPs, the RNA-binding FOX homolog (RBFOX) proteins4, exert widespread effects on neuronal gene splicing5,6,7. However, the functional repertoire of RBFOX proteins remains undefined, partly because the three proteins in this family, RBFOX1 (A2BP1), RBFOX2 (Rbm9) and RBFOX3 (NeuN) appear to have both common and distinct properties4, 8. Rbfox genes are differentially expressed; Rbfox1 in neurons, heart and muscle, Rbfox2 more widely in neurons, muscle and multiple progenitor cells, whereas Rbfox3/NeuN is famously neuron-specific4. In the adult brain, all three RBFOX proteins are widely, but again, differentially expressed across different regions9. RBFOX proteins share a consensus RNA binding sequence (U)GCAUG that interacts with a conserved RNA recognition motif (RRM) within a central region of all RBFOX proteins. Position-dependent binding of RBFOX proteins relative to alternative exons can mediate either exon inclusion (downstream intronic binding), or exon skipping (upstream intronic binding)7, 10. N-terminal (NTD) and C-terminal (CTD) domains of the RBFOX proteins are important additional determinants of cell-specific function11,12,13.
Our work demonstrating an absence of the ‘pan-neuronal’ RBP, RBFOX3/NeuN, from the majority of SCN neurons14 is indicative of significant changes in splicing regulation within this hypothalamic population that may underlie specific functional requirements of this integrative centre in the brain15. Previous studies have provided evidence of SCN-selective gene splicing16,17,18, but the mechanistic basis of these differences is unknown. In the current study, we have now addressed one aspect of splicing regulation in this brain region by analysing SCN expression and activity of the Rbfox3/NeuN sister gene, Rbfox2.
Rbfox2 was selected for this study because the RBFOX3/NeuN-negative14, SOX2-positive19 phenotype of SCN neurons is consistent with relative neuronal immaturity. Rbfox2 is a good candidate because unlike the other Rbfox genes, it is expressed early in neuronal development, and in particular, is found in early post-mitotic neurons in addition to mature neurons9, 20,21,22. Also, recent studies have shown that cortical Rbfox2 expression decreases in the adult brain (in general), whereas Rbfox1 has the opposite temporal profile23. Therefore, Rbfox2 appears a likely candidate for possible expression in ‘immature’, RBFOX3-depleted, adult SCN neurons. Currently, Rbfox2 is known to have a specific role in cerebellar development24, but roles of Rbfox2 in the adult brain are undefined.
Results
RT-PCR identification of rat brain Rbfox2 cDNA
In the absence of published sequence information on rat brain Rbfox2 transcripts, PCR primers (Table S1) were based on (i) a partially annotated rat transcript (NM_001079895.1), and (ii) rat genome sequence corresponding to mouse transcripts that have an alternative translation start site (eg. NM_001286418). The primer pairs used for this analysis thereby target the two alternative ATG codons recognized in mouse and human Rbfox2 transcripts11, together with a full-length open reading frame with known (alternative) N-terminal, RRM, and C-terminal domains (Fig. 1). However, potential alternative 5′ and 3′ UTR sequence is not addressed using this primer design. RT-PCR analysis revealed two distinct Rbfox2 transcripts in rat cerebral cortex but a very marked, and consistent, abundance of the ‘MEKK’ start transcript compared with the ‘MAEG’ transcript (Fig. 1A). This result was essentially identical in rat SCN (Fig. S1) and, superficially, levels of MEKK-containing transcripts were similar in SCN and cortex (Fig. 1A). Given these results, subsequent experiments were focused on MEKK-containing transcripts/protein (see protein data below), but it is recognized that these RT-PCR analyses do not exclude the expression of alternative transcripts. Initial sequence analysis of the RT-PCR-generated rat cortex MEKK transcript revealed a 1175 bp sequence that includes some 5′ and 3′ UTR sequence included in primers RBFF6 and RBFR3 (Supplemental data, SI1). Mapping this sequence to the rat genome with BLAT indicates division into 13 exons. The open reading frame (ORF) sequence of 1143 bp codes for a 381 amino acid protein that is homologous to, and highly conserved with, annotated mouse (NP_001104298.1; 99.7% identity) and human (NP_001336926.1; 98.7% identity) RBFOX2 isoforms. Of note, the predicted CTD is 100% conserved across these 3 species.
RBFOX2 has abundant nuclear expression in SCN
Given the identification of ‘MEKK’-containing Rbfox2 transcripts in rat cortex and SCN, we next used an antibody directed against this N-terminal epitope to analyse RBFOX2 protein expression in adult rat brain (Fig. 2). This analysis revealed abundant (MEKK) RBFOX2 protein in rat brain, including cortex (Figs 2 and S2), and also showed that this isoform ‘family’ (see results below) is similarly abundant in the SCN, a region where the related NeuN/RBFOX3 protein is unusually sparse (Fig. 2A–C). Microscopic inspection of RBFOX2 immunoreactivity within individual cells of the SCN did not reveal any distinction in RBFOX2 levels between NeuN-ve and the rare NeuN + ve cells (Fig. S2), and RBFOX2 was broadly expressed across the SCN with no apparent localization to sub-region (Fig. 2B). Further inspection of RBFOX2 immunoreactivity indicated an exclusively nuclear distribution in the adult rat brain regions analysed here (Fig. 2D–F). Expression of RBFOX2 in the nuclear region of neurons was confirmed by co-localization with MeCP2 (Fig. S3). In order to extend our understanding of the distribution of RBFOX protein in rat brain, further analysis of neonatal rat brain (Fig. 2G–I) revealed some neurons with distinctive RBFOX2 localization in extra-nuclear regions of the cells.
Distinct populations of Rbfox2 isoforms in the SCN and cortex
Following the initial identification of MEKK-containing transcripts in adult rat cortex (above), we cloned and sequenced a similar PCR product from adult rat SCN and were surprised to find a sequence with two internal variations (12 bp deletion at the start of exon 9, and a 40 bp full deletion of exon 10; a variant termed −12–40; Supplemental data SI1 and 2). Attempts to confirm this result revealed additional sequence variation, and so we undertook a systematic analysis of both cortex and SCN transcript sequences from multiple independent samples of rat brain (Table 1). This analysis revealed a diversity of transcripts in both brain regions, but at the same time, a clear distinction in isoform populations.
In this sequence analysis of 44 clones (22 SCN, 22 cortex; each from 3 independent samples), a total of 6 loci of variation across the Rbfox2 ORF were identified (Supplemental data SI1 and 2), with multiple different events at some of these sites, giving rise to a total of 11 distinct isoforms, including the ‘non-variant’ sequence identified above (Fig. 1C; Table 1, Supplemental data, SI1 and SI2). All of these isoforms are novel in this biological context, and therefore this study provides the first experimental evidence for the expression of these isoforms. It should be noted, however, that many of these isoforms are Gnomon-predicted from ab initio modelling (Table 1; www.ncbi.nlm.nih.gov/genome/annotation_euk/gnomon), and some involve documented alternatively spliced exons (see Discussion). ORF analysis indicates a direct correspondence between isoform sequence and our detected brain protein expression because all of the cloned isoforms maintain the N-terminal region recognized by the antibody used in the immunohistochemical analysis. Furthermore, our demonstration of (primarily) nuclear RBFOX2 in adult brain indicates the presence of functional nuclear localization signals (NLS) within the complement of different isoforms, and this appears to hold because, although many of the isoforms lack the known C-terminal NLS13 and the recently identified N-terminal NLS13 a conserved NLS (KSTPKRLHVSNIPFRFRDPDLRQMFGQFGKI) is identified in the majority of isoforms using the CNLA Mapper software. Remarkably, given the nature of the relatively short sequence insertions and deletions found here, only one of the sequenced variants is associated with premature termination of the ORF, and likely targeting for nonsense-mediated decay (NMD). This is the −93/+73 isoform, identical to a mouse isoform identified by Dredge & Jensen25 as targeted for NMD due to a nonsense codon more than 50–55 bp upstream of an exon-exon junction. All other isoforms exhibit maintenance of a similarly sized ORF, terminating in either ‘FAPY’ or ‘TEVT’. This organization is dependent upon the use of different (alternative frame) termination codons that are spaced 7 bp apart at the 3′ end of the coding sequence.
Clearly, the pattern of differential isoform expression between SCN and cortex is complex and does not have an overt functional distinction, particularly given that the functional activities of each isoform have not been experimentally defined. However, our data reveal a 3-fold higher abundance of the −12–40 isoform in SCN compared with cortex (Table 1), and this isoform also represents >50% of the SCN isoforms. The −12 bp deletion results in a loss of the amino acid sequence SLPLV from the N-terminal region of the CTD, and the −40 deletion results in an almost complete loss of sequence identity from VYQD in the CTD until the end of the coding sequence (Supplemental data, SI4 and SI5). Given the differential expression of this isoform, we therefore selected the −12–40 isoform for functional analysis (see below; Genbank accession number: MF177287).
RBFOX2 target sequences rat brain isoforms
Although multiple factors contribute to differential splicing of neuronal genes4, RBFOX protein auto-regulation may be involved, and therefore an analysis of rat genomic sequence at the Rbfox2 locus was conducted in order to identify patterns of RBFOX binding sites ([U]GCAUG) that would be consistent with auto-regulation. This analysis (see Fig. 1C) provided evidence for Rbfox-mediated regulation of Rbfox2 isoform generation. Of note, there are consensus sites proximal to exon 10 and the alternative exon 10 which would be consistent with exon exclusion and inclusion respectively, and also proximal sites around the alternatively utilized exon 5. In other cases, such as the 12 bp loss from exon 9, no consensus sites are found, indicating alternative mechanisms of sequence variation in Rbfox2 isoforms.
RBFOX splicing targets in SCN genes
Previous studies of RBFOX protein function have identified multiple exons that are included/excluded from target gene transcripts through RBFOX-dependent mechanisms (see Discussion). In order to investigate comparative RBFOX activity in the SCN, four of these exon targets were analysed using RT-PCR to provide a comparison of exon inclusion/exclusion in the SCN and cortex (Figs 3A and B; S4). Initially, we analysed exon 4 (Transcript: ENSRNOT00000037725.5), of the NMDA receptor gene, Grin1, which in addition to being a known RBFOX target exon9, 23 [termed exon 59], is also known to be differentially regulated in SCN (exon excluded) compared with cortex (exon included)16, 17. Consequently, our demonstration that this exon is excluded from SCN (but not cortex) transcripts in our samples (Fig. 3A), is not only indicative of a region-specific difference in RBFOX activity, but also serves to confirm SCN sample integrity, given the previous in situ hybridization data for SCN expression16, 17.
We have also demonstrated brain region-specific regulation in two other genes that contain known RBFOX target exons, but which have not previously been analysed in the SCN (Fig. 3A). First, Enah (aka Mena) exon 12 (Transcript: ENSRNOT 00000085188.1), which has a lower expression in the SCN, consistent with a loss of RBFOX activity7, 26. Second, Cacna1c (aka Cav1.2) exon 7 (Transcript: ENSRNOT00000052017.6) that is clearly expressed in SCN, but only minimally in cortex (Fig. 3), again, consistent with a loss of RBFOX activity10 (termed exon 9*). A quantitative analysis of Cacna1c exon 7 inclusion revealed a significantly higher level of exon 7 included transcripts in SCN when expressed as a percentage of total PCR product (SCN: 7.0 ± 0.4%, Cortex: 1.7 ± 0.4%; p < 0.05, Independent Student’s t test, n = 3/group, values are Mean ± SEM). In contrast, Cacna1c exon 29 inclusion is complete in both SCN and cortex, which is not surprising given that regulated exclusion of this exon has been shown to terminate on embryonic day 16 in mouse brain10 (termed exon 33). Overall, these analyses are consistent with a relatively lower level of RBFOX spicing activity in SCN compared with cerebral cortex.
Distinct population of Rbfox2 isoforms in a neuronal cell line
To establish a cellular model for the investigation of Rbfox2 isoform function, rat PC12 pheochromocytoma cells were cultured and analysed for expression of both endogenous Rbfox2, and known RBFOX2 target genes. RT-PCR with the RBFF6 and RBFR3 primers used for rat brain analysis produced abundant expression of a product that appeared similar to the PCR bands obtained with SCN and cortex RNA (Fig. 1A). However, cloning and sequencing of these cDNAs revealed a set of sequences largely distinct form either of the rat brain samples (Supplemental data, SI3). Of 6 sequenced clones, one was identical to the original ‘non-variant’ sequence cloned from rat cortex, but the remaining 5 clones (−12 × 2; −3b-12; −2–40 + 43 × 2) were distinct from both the SCN and cortex populations, with a notable absence of both the −12–40 isoform, and any −93 isoforms in the PC12 population. In contrast, an isoform containing a substitution of exon 10 (−40) with a well-established alternative exon 10* (+43)7 was found. This result is indicative of the undifferentiated state of the PC12 cells because the alternative (+43) exon is known to be absent in brain mRNAs7. However, this clone also contained a novel −2 bp deletion, an apparent micro-exon flanked by GT and AG sequences. Overall, the 3 variations in this clone result in a truncated predicted protein sequence (Supplemental data, SI3).
Initial analysis of RBFOX target genes in PC12 cells revealed abundant expression of both exon 7-included and exon 7-excluded Cacna1c transcripts (Fig. 3C and D), making this exon an ideal target for functional analysis of Rbfox2 isoforms.
The SCN-abundant RBFOX2 isoform is functionally impaired
Given that the (−12–40) isoform is the most abundant clone in the rat brain sample set, and furthermore distinguishes the SCN and cortex populations, a functional analysis of this isoform was conducted using the equivalent (‘non-variant’) isoform for comparison. This analysis focused on two aspects of RBFOX function using PC12 cells as an experimental model: (i) effect on inclusion of Cacna1c exon 7 (see above), and (ii) effect on gene expression (selecting Egr1 as a documented example gene)27.
The non-variant Rbfox2 construct was functionally verified in initial transfection experiments that demonstrated a marked decrease in Cacna1c exon 7 inclusion following 24 h of over-expression (Fig. 3C). In contrast, no change in expression of Cacna1c exon 29 was observed (Fig. 3C). Interestingly, analysis of Rbfox2 expression using primers RBFF4 and RBFR3, that detect both endogenous and exogenous Rbfox2 transcripts, revealed not only an anticipated over-expression of Rbfox2, but also (sequence-verified) expression of a (‘−40’; 365 bp) product in the Rbfox2-transfected cells, presumably reflecting exclusion of the 40 bp exon 10 from endogenous Rbfox2 transcripts. Following this verification of functional RBFOX2 activity in the transfection paradigm, additional experiments were conducted to quantitatively compare this activity with the −12–40 isoform. Despite similar levels of construct expression (verified by amplification of a PCR product derived from the 5′ UTR region of pcDNA3.1 coupled with a Rbfox2-specific reverse primer; Fig. 3D), expression of the −12–40 isoform did not significantly modify Cacna1c exon 7 inclusion (Fig. 3D).
In contrast to the differential splicing activity of the rat brain Rbfox2 constructs demonstrated above, neither construct significantly modified Egr1 mRNA levels in this cellular model. Fold changes in Egr1 mRNA level for the different transfections compared to pcDNA3.1 were: ‘non-variant’ Rbfox2, 0.92 ± 0.19, and −12–40, 1.12 ± 0.17 (n = 4 replicate transfections in each group; ANOVA: F = 0.465 (11), p = 0.642). Actb is also a documented RBFOX target23 and although not quantitatively analysed here, expression did not appear to be modified by rat brain Rbfox2 construct over-expression (Fig. 3C and D).
Discussion
The RBFOX family of RNA binding factors are established regulators of neuronal gene expression4. Individual family members are known to be required for aspects of adult brain function28, but, in general, the roles of these RBPs in adult brain are largely undefined. In the present study, we have shown that Rbfox2 is expressed in a remarkable diversity of isoforms in the adult brain, and also that different brain regions have characteristic isoform populations. This analysis has also revealed that RBFOX activity in the RBFOX3/NeuN-depleted SCN, appears to be compensated by a change in Rbfox2 isoform population rather than a change in expression levels. In the SCN, an abundance of a CTD-variant Rbfox2 isoform (−12–40) is associated with distinct patterns of exon utilization in RBFOX target genes. Previous studies have highlighted individual RBFOX isoforms in the brain, for example a cytoplasmic variant of RBFOX129, but the diversity of neuronal isoform variation has not previously been documented. Our comparative analysis of the cerebral cortex with the SCN has perhaps contrasted two extremes, given the unusual, RBFOX3-negative nature of the majority of SCN neurons, and so further analysis is required to extend these findings to other neuronal populations in order to identify the extent of variation across the brain.
Our study has also demonstrated a functional correlate of the distinct Rbfox2 isoform populations, in that the SCN-enriched CTD-variant Rbfox2 isoform lacks the functional activity of an equivalent non-variant isoform. As a consequence, the relative loss of RBFOX2-mediated exon exclusion from a L-type calcium channel gene, Cacna1c, may underlie the presence of this exon within SCN Cacna1c transcripts. These findings have additional relevance to this study because inclusion of this exon is known to be developmentally down-regulated in brain cortex10, providing further evidence of an immature molecular phenotype in the SCN14, 19. Our control experiments have confirmed RBFOX2-mediated exclusion Cacna1c exon 7, as originally demonstrated by Tang and colleagues10, and provide an interesting in vivo context for this activity because these authors showed that the Cacna1c exon responds to relatively small changes in RBFOX2 levels. Hence, differences in the relative proportions of Rbfox2 isoforms between SCN (eg. −12–40, >50%) and cortex (<20%) are likely to be functionally relevant.
The major importance of alternative splice regulation in neurons lies in the generation of protein isoforms with altered properties; variant ion channels, for example, which affect neurophysiological output, and therefore information processing30. Inclusion of Cacna1c exon 7 has been shown to modify the electrophysiological properties of the Cacna1c-encoded CaV1.2 channels10. Regulated splicing of the CaV1.2 channel is interesting in the context of this study because CaV1.2 is involved in resetting of the circadian clock within the SCN31. However, the Cacna1c gene is subject to extensive splice variation, and the physiological significance of much of this variation remains undefined32.
We have also provided evidence of other RBFOX-targeted gene exons, Grin1 exon 45 and Enah exon 127, 26 that are differentially expressed in the SCN, also reflecting an apparent relative loss of RBFOX activity. For the NMDA receptor subunit gene Grin1, we have confirmed an absence of the variable exon 4 in SCN mRNAs16, 17 and, conversely, clear exon 4 expression in cerebral cortex33, 34. Inclusion of Grin1 exon 4 is directly mediated by RBFOX proteins, presumably via a cluster of binding sites downstream of exon 45. For the Enah gene, not previously been studied in the SCN, we show for the first time that exon 12, a known RBFOX-regulated exon26 is included in cortical transcripts, but not in SCN transcripts.
Exons in the Cacna1c, Grin1 and Enah genes are experimentally verified RBFOX2 targets as established in an extensive HITS-CLIP analysis of individual RBFOX proteins23. In the latter study, genome-wide RBFOX exon targets are ranked according to FDR score: Rbfox2 (+93) is ranked 9, Grin1 (exon5) ranked 4, and Cacna1c (exon 9) ranked 554. Also, in this study, the potassium channel gene Kcma1 is identified as a major target of RBFOX with exons ranked in positions 198, 376 and 669. We have not studied the Kcnma1 in the current study but previous work has identified that the ‘STREX’ splicing site18 lacks inserts in the SCN, again consistent with relative loss of RBFOX activity in these neurons due to prediction of exon inclusion in the HITS-CLIP analysis18.
The generation of Rbfox2 isoforms observed in the current study may be multifactorial, involving different RBPs, and other molecular mechanisms. However, given the extensive evidence of Rbfox autoregulation35, it is likely that differential isoform generation is at least partly RBFOX-regulated. For example, the abundance of the −93 isoform in cortex relative to SCN would be consistent with RBFOX3/NeuN enhanced skipping of RRM exons that generate this dominant negative isoform25, 36. In contrast, the relative absence of RBFOX3/NeuN in the SCN removes this influence on Rbfox2 isoform generation25, resulting in a distinct population of neuronal isoforms. Our analysis of genomic sequence around regulated Rbfox2 exons has identified potential target sequences that are proximally positioned to mediate auto-regulation. This analysis is supported by recent genome-wide analyses of RBFOX target sites7, 23 that identify the ‘40’ and ‘93’ exons as targets. Many RBFOX consensus sites are located distally (>500 nt) from exons, but it should be noted that RNA bridges can mediate distal regulation37.
Our major finding of a multiplicity of Rbfox2 isoforms in the adult brain raises the question of protein function associated with these individual variations. Our sequence evidence implies that these variants are translated because most sequence variations are integrated with alternative stop codon usage that maintains an open reading frame. Previous evidence also shows that alternative Rbfox transcripts are associated with translated proteins and not simply subject to NMD5. Consequently, it is possible to generate many different proteins with different functional properties, relating to one or more aspects of RNA binding, protein interaction and cellular (nuclear/cytoplasmic) localization. Previous studies have identified RBFOX2 isoforms with dominant negative activity, for example the −93 isoform can act as a dominant negative because the RRM is partially deleted leading to reduced RNA binding but maintained association with other splicing factors36. Our results may indicate a requirement for such activity in cortical neurons where these isoforms are more abundant. The relatively lower level of these isoforms in SCN would be consistent with a need to compensate for the loss of RBFOX3/NeuN in these neurons. However, our current analysis of Rbfox2 expression in the SCN is generally consistent with a relative loss of RBFOX activity that appears to be appropriate for the required splicing patterns in functional SCN genes.
The SCN is characterized by an abundance of the −12–40 isoform that codes for a CTD-variant isoform. Alternative usage of the 40 bp exon 10 in mouse brain and muscle has been documented previously38, but the 40 nt exon 10 was substituted with a 43 nt exon rather than deleted. In the rat brain areas analysed here, we have found that deletion of the 40 bp exon 10 is exclusively associated with an additional, novel deletion of an upstream 12 bp sequence. The resultant amino acid changes in the CTD are significant, involving loss of alanines, (33 A’s in the ‘non-variant’ protein compared with 16 in −12–40, and loss of a ATATAATAAAAAAAAY sequence) and addition of glutamine (+5) and proline (+11) residues, resulting in five closely-spaced QP dimers. These changes may be crucial for splicing function because the CTD is required for RBFOX2 splicing activity39,40,41,42, acting, at least partly, to mediate protein interactions12, 41. CTD variation may relate to the recently demonstrated, but unexplained selection of distinct RBFOX binding sites by RBFOX28. Alternatively, the variant CTD may confer other, non-splicing, functions related to mRNA processing (see below), possibly explaining the enrichment of glutamines43 and QP repeats44.
Although much of the work on RBFOX proteins has necessarily focused on their role in splicing, recent work has provided evidence for other regulatory roles. Both RBFOX145 and RBFOX246, 47 can modify mRNA levels in the cytoplasm via actions at the 3′ UTR. In the adult rat brain including the SCN, we found no evidence of cytoplasmic RBFOX2. However, other recent work has shown that RBFOX2 can have a more general role in gene regulation, acting (largely) as a transcriptional repressor in conjunction with polycomb complex 2 (PRC2)27. The RBFOX2 protein domain interacting with PRC2 is the CTD, shown here to be significantly modified in the SCN-abundant −12–40 isoform. A consequent change in gene repression in the SCN may therefore explain some of the unusual patterns of gene expression in SCN neurons14, 19. In the current study, one of the RBFOX2-suppressed genes, Egr1 27, was measured in an RBFOX2 over-expression paradigm, but no consistent changes in Egr1 expression were observed. Further studies, possibly in other cellular contexts27, are required to confirm these regulatory actions of RBFOX2.
In conclusion, our demonstration of distinct populations of Rbfox2 variants in the adult brain is consistent with our widening knowledge of neuronal transcript diversity, as demonstrated in current single-cell sequencing projects48. Our additional finding of further (novel) variants in PC12 cells is suggestive of a multiplicity of Rbfox2 transcript populations that may be a defining feature of individual cell types. In the SCN, where RBFOX3/NeuN is largely absent, our finding that there are similar levels of Rbfox2 transcripts and protein but distinct isoform populations is indicative of a novel cellular strategy for directing cell-specific RBFOX activity. Further studies are required to understand how the changes in Rbfox expression may relate to specific SCN function; for example, ‘immature’ aspects of SCN physiology49, or possibly the requirement for daily cycles of regulated splicing18, 50, 51.These studies must take into account other RBPs such as NOVA, which can act synergistically with RBFOX proteins to regulate neuronal gene splicing52, and also activity of RBFOX1. At a more general level, the current insights into brain Rbfox2 gene expression may have clinical relevance because the RBFOX-regulatory network is associated with autism, and RBFOX-target genes, including Cacna1c, are recognized autism susceptibility genes23.
Methods
Animals
Sprague-Dawley male rats were used in accordance with both the UK Animals (Scientific Procedures) 1986 Act of Parliament, and Cardiff University ethical review. All experimental protocols were approved by, and conducted under, UK Home Office licencing. The health status of the animals was monitored by a veterinarian. Rats were maintained in standard laboratory conditions (14:10 light:dark cycle, lights on: 05.00 h) with ad libitum access to rodent food and drinking water, and sampled at 17.00 h. For immunohistochemical analysis of postnatal day 50 (PND50) brain, animals were terminally anaesthetized with sodium pentobarbitone (150 mg/kg, i.p), and perfused via the ascending aorta with phosphate buffered saline (PBS), followed by 4% paraformaldehyde in 0.1 M phosphate buffer (PFA). Dissected brains were then post-fixed (PFA, overnight, 4 °C). Alternatively, for PND10 rats killed by a Schedule 1 method, brains were rapidly dissected prior to fixation in 4% PFA (24 h, 4 °C). Both PND50 and PND10 brains were then cryoprotected (20% sucrose in 0.1 M phosphate buffer; PND50: overnight, 4 °C; PN10: 24 h, 4 °C), and stored briefly at –80 °C prior to sectioning. For RT-PCR analysis of PND50 brain, rats were killed by a Schedule 1 method, and discrete punches of SCN and cerebral cortex (parietal) tissue were sampled using a method53 optimized by the use of a rat brain matrix (RBMA-300C, World Precision Instruments Inc., Sarasota, FL, USA) and blunted 15 G needles. Tissue from 3 rats was pooled in each sample used for RT-PCR.
Immunohistochemistry
Coronal sections of rat brain (12 µm; bregma 0.0 mm to −2.0 mm)54 were prepared using a cryostat (Leica CM1900; Leica Imaging Solutions Ltd., Cambridge, UK), and mounted on glass slides (SuperFrost Plus, VWR International Ltd., East Grinstead, West Sussex, UK). Following brief drying, slides were stored at −80 °C prior to analysis. Sections containing the SCN were selected, and protein expression was analysed using fluorescence immunohistochemistry55. The primary antibodies used for immunohistochemistry (RBFOX2, RBM9 IHC-00199, Bethyl Laboratories Inc., Montgomery, TX, USA; NeuN/RBFOX3, MAB377, Millipore, Temecula, CA, USA), and MeCP2 (4B4, Active Motif, Carlsbad, CA, USA), have been used in our previous studies19, 55, 56, and have been validated both positively (excitation light-specific detection), and negatively (absence of detection when the primary antibody is omitted). The epitope recognized by IHC-00199 maps to a region in the N-terminal domain (residues 1–50 of hRBFOX2; NP_055124.1) that is 100% conserved between human and rat. Note that this antibody will not distinguish RRM and CTD variants of RBFOX2. The secondary antisera used were: Cy3-conjugated sheep anti-rabbit IgG (Sigma Aldrich, Dorset, UK), and Alexa Fluor 488-conjugated donkey anti-mouse IgG, (Molecular Probes Inc, Eugene, OR, USA). Following washing, sections were mounted in Vectashield with DAPI (Vector Laboratories, Burlingame, CA, USA), stored at 4 °C, and then viewed with a fluorescence microscope (Leica DM-LB, Leica). Representative images were photographed with a Leica DFC-300FX digital camera linked to Leica QWin software (V3), and assembled in Photoshop (CS2, Adobe Systems Inc., San Jose, CA, USA). Expression of RBFOX2 in the SCN was confirmed in at least 6 brain sections from 2 rats.
RT-PCR analysis of rat brain mRNAs
Total cellular RNA was extracted from rat brain samples using Trizol (Invitrogen protocol, Thermo Fisher Scientific, Waltham, MA, USA) and DNaseI-purified (Promega protocol; Promega, Madison, WI, USA). cDNA was generated with the Superscript II protocol (Life Technologies, Thermo Fisher Scientific) using an Oligo (dT) primer. PCR was conducted using standard procedures with either REDTaq ReadyMix (Sigma, Aldridge, St.Louis, MO, USA), or Q5 Hot-Start High-Fidelity DNA polymerase (NEB, Ipswich, MA, USA). Oligonucleotides used for amplification are listed in Table S1. Amplified products were visualized after agarose gel electrophoresis, with reference to a DNA ladder (Hyperladder I, Bioline, London, UK or 1 kb ladder, Promega), using GeneSnap (Syngene, Frederick, MD, USA), and relative levels of PCR bands measured using Image J57. For cloning and sequence analysis, PCR products were purified (Qiaex II gel extraction kit, Qiagen, Hilden, Germany) and either directly ligated into pGEM-T (Promega protocol), or, in the case of Q5-amplified products, ‘A-tailed’ (Promega protocol) prior to ligation. Ligations were transformed into JM109 cells (Promega), and transformants were selected for plasmid purification (Wizard SV Miniprep protocol, Promega). PCR products were then sequenced (Eurofins MWG Operon, Ebersberg, Germany).
For the analysis of Rbfox2 isoform distribution within different brain areas, a total of 44 clones were sequenced (22 SCN comprising 10, 6 and 6 clones from SCN sample pools (3 rats in each pool) A, B & C respectively; 22 cortex comprising 10, 6 and 6 clones from Cortex sample pools (3 rats in each pool) A, B & C respectively). For the analysis of RBFOX splicing targets in SCN and cortex, exon exclusion/inclusion was verified in at least two independent PCR reactions using independent brain samples from the same sample pools used for Rbfox2 isoform analysis. A quantitative analysis of Cacna1c exon 7 inclusion in SCN and cortex was conducted by measuring the relative levels of exon 7 included, and excluded products (see Results).
Quantitative RT-PCR analysis
For the quantitative analysis of Egr1 mRNA levels, real-time PCR analysis was performed with the qPCRBIO SyGreen Mix (PCR Biosystems protocol, PCR Biosystems Ltd, London, UK) on a Mx3000P machine (Agilent, Santa Clara, CA, USA) using the 2−ΔΔCT method for quantitation. For this analysis, reverse transcription reactions (see above) were conducted using a mixture of oligo (dT) and an 18S-specific primer in order that 18S RNA (template diluted 1/1000 for QPCR) could be used for reference58. This approach for normalization was adopted due to the reported widespread effects of RBFOX2 across the transcriptome27.
Expression of Rbfox2 isoforms in cell culture
PC12 cells (Gift of Prof. D. Murphy, University of Bristol, UK) were grown in DMEM with 10% horse serum, 5% Fetal Bovine Serum and 1x antibiotic/antimycotic (Invitrogen) at 37 °C and 5% CO2. For experimental analysis, cells (1 × 105/well of a 12-well plate;) were transfected (TransFast protocol, Promega) with Rbfox2 constructs (250 ng, PureYield plasmid, Promega protocol) and maintained for 24 h prior to RNA extraction using Trizol (Invitrogen protocol). RNA samples were reverse transcribed as described above and transcripts were analysed using end-point PCR (REDTaq Readymix) with cycle numbers appropriate for individual transcripts (range: 28–34 cycles). Following agarose gel electrophoresis, gel images were captured (GeneSnap, Syngene) and relative levels of PCR bands measured using Image J57. Rbfox2 expression constructs were based on isoform sequences obtained in the analysis of rat brain transcripts. Selected Rbfox2 sequences were re-amplified using primers containing 5′ HindIII or BamHI sites, sequence-verified, and then ligated into the MCS of pcDNA3.1(+). In order to optimize expression of RBFOX2 protein, the 5′ UTR was modified with a single (non-coding) base change to generate a consensus Kozak sequence. For the analysis of endogenous PC12 Rbfox2 transcripts, PC12 cells were similarly plated and maintained in the absence of transfection. Following RNA extraction, PC12 Rbfox2 transcripts were cloned and sequenced as described above (total of 6 Rbfox2 clones).
Bioinformatics and statistical analysis
Genomic and transcript analysis was performed using the UCSC and Ensembl Genome Browsers (genome.ucsc.edu; ensembl.org). Sequence identity was initially confirmed using BLAST (blast.ncbi.nlm.nih.gov), and sequence comparisons were conducted with Clustal Omega (ebi.ac.uk/Tools/msa/clustalo). Nuclear localization signals were identified using CNLS MAPPER (nls-mapper.iab.keio.ac.jp/cgi-bin/NLS_Mapper_form.cgi). Statistical analysis was conducted with IBM SPSS Statistics version 20 (IBM, New York, USA) by applying different tests as indicated in Results, and Levene’s test for equality of variance. The requirement to use multiple end-point PCR reactions for comparative analysis of endogenous splice variation across single exons necessarily compromises inter-assay variation, and therefore independent Student’s t-tests were used to compare the activity of the two expression constructs with control transfections.
References
Raj, B. & Blencowe, B. J. Alternative Splicing in the Mammalian Nervous System: Recent Insights into Mechanisms and Functional Roles. Neuron 87, 14–27 (2015).
Yang, X. et al. Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing. Cell 164, 805–817 (2016).
Fu, X. D. & Ares, M. Jr. Context-dependent control of alternative splicing by RNA-binding proteins. Nat. Rev. Genet. 15, 689–701 (2014).
Darnell, R. B. RNA protein interaction in neurons. Annu. Rev. Neurosci. 36, 243–270 (2013).
Lee, J. A., Tang, Z. Z. & Black, D. L. An inducible change in Fox-1/A2BP1 splicing modulates the alternative splicing of downstream neuronal target exons. Genes Dev. 23, 2284–2293 (2009).
Zhang, C. et al. Defining the regulatory network of the tissue-specific splicing factors Fox-1 and Fox-2. Genes Dev. 15, 2550–2563 (2008).
Yeo, G. W. et al. An RNA code for the FOX2 splicing regulator revealed by mapping RNA-protein interactions in stem cells. Nat. Struct. Mol. Biol. 16, 130–137 (2009).
Zhang, X. et al. Cell-Type-Specific Alternative Splicing Governs Cell Fate in the Developing Cerebral Cortex. Cell 166, 1147–1162 (2016).
Kim, K. K., Kim, Y. C., Adelstein, R. S. & Kawamoto, S. Fox-3 and PSF interact to activate neural cell-specific alternative splicing. Nucleic Acids Res. 39, 3064–3078 (2011).
Tang, Z. Z., Zheng, S., Nikolic, J. & Black, D. L. Developmental control of CaV1.2 L-type calcium channel splicing by Fox proteins. Mol. Cell. Biol. 29, 4757–65 (2009).
Arya, A. D., Wilson, D. I., Baralle, D. & Raponi, M. RBFOX2 protein domains and cellular activities. Biochem. Soc. Trans. 42, 1180–1183 (2014).
Sun, S., Zhang, Z., Fregoso, O. & Krainer, A. R. Mechanisms of activation and repression by the alternative splicing factors RBFOX1/2. RNA 18, 274–283 (2012).
Wenzel, M. et al. Identification of a classic nuclear localization signal at the N terminus that regulates the subcellular localization of Rbfox2 isoforms during differentiation of NMuMG and P19 cells. FEBS Lett. 590, 4453–4460 (2016).
Geoghegan, D. & Carter, D. A. A novel site of adult doublecortin expression: neuropeptide neurons within the suprachiasmatic nucleus circadian clock. BMC Neurosci. 9(2), 10.1186 (2008).
Takahashi, J. S. Transcriptional architecture of the mammalian circadian clock. Nat. Rev. Genet. 18, 164–179 (2017).
Bendová, Z., Sumová, A. & Mikkelsen, J. D. Circadian and developmental regulation of N-methyl-d-aspartate-receptor 1 mRNA splice variants and N-methyl-d-aspartate-receptor 3 subunit expression within the rat suprachiasmatic nucleus. Neuroscience 159, 599–609 (2009).
Duffield, G. E., Mikkelsen, J. D. & Ebling, F. J. Conserved expression of the glutamate NMDA receptor 1 subunit splice variants during the development of the Siberian hamster suprachiasmatic nucleus. PLoS One. 7, e37496, doi:10.1371/journal.pone.0037496 (2012).
Shelley, C., Whitt, J. P., Montgomery, J. R. & Meredith, A. L. Phosphorylation of a constitutive serine inhibits BK channel variants containing the alternate exon “SRKR”. J. Gen. Physiol. 142, 585–598 (2013).
Hoefflin, S. & Carter, D. A. Neuronal expression of SOX2 is enriched in specific hypothalamic cell groups. J. Chem. Neuroanat. 61-62, 153–160 (2014).
Underwood, J. G., Boutz, P. L., Dougherty, J. D., Stoilov, P. & Black, D. L. Homologues of the Caenorhabditis elegans Fox-1 protein are neuronal splicing regulators in mammals. Mol. Cell Biol. 25, 10005–10016 (2005).
Venables, J. P. et al. RBFOX2 is an important regulator of mesenchymal tissue-specific splicing in both normal and cancer tissues. Mol. Cell Biol. 33, 396–405 (2013).
Chen, P. F., Hsiao, J. S., Sirois, C. L. & Chamberlain, S. J. RBFOX1 and RBFOX2 are dispensable in iPSCs and iPSC-derived neurons and do not contribute to neural-specific paternal UBE3A silencing. Sci Rep. 6, 25368, doi:10.1038/srep25368 (2016).
Weyn-Vanhentenryck, S. M. et al. HITS-CLIP and integrative modeling define the Rbfox splicing-regulatory network linked to brain development and autism. Cell Rep. 6, 1139–1152 (2014).
Gehman, L. T. et al. The splicing regulator Rbfox2 is required for both cerebellar development and mature motor function. Genes Dev. 26, 445–460 (2012).
Dredge, B. K. & Jensen, K. B. NeuN/Rbfox3 nuclear and cytoplasmic isoforms differentially regulate alternative splicing and nonsense-mediated decay of Rbfox2. PLoS One. 6, e21585, doi:10.1371/journal.pone.0021585 (2011).
Braeutigam, C. et al. The RNA-binding protein Rbfox2: an essential regulator of EMT-driven alternative splicing and a mediator of cellular invasion. Oncogene 33, 1082–1092 (2014).
Wei, C. et al. RBFox2 Binds Nascent RNA to Globally Regulate Polycomb Complex 2 Targeting in Mammalian Genomes. Mol. Cell 62, 875–889 (2016).
Wang, H. Y. et al. RBFOX3/NeuN is Required for Hippocampal Circuit Balance and Function. Sci Rep. 5, 17383, doi:10.1038/srep17383 (2015).
Hamada, N. et al. Role of the cytoplasmic isoform of RBFOX1/A2BP1 in establishing the architecture of the developing cerebral cortex. Mol. Autism 6, 56, doi:10.1186/s13229-015-0049-5 (2015).
Raingo, J., Castiglioni, A. J. & Lipscombe, D. Alternative splicing controls G protein-dependent inhibition of N-type calcium channels in nociceptors. Nat. Neurosci. 10, 285–292 (2007).
Schmutz, I. et al. A specific role for the REV-ERBα-controlled L-Type Voltage-Gated Calcium Channel CaV1.2 in resetting the circadian clock in the late night. J. Biol. Rhythms 29, 288–98 (2014).
Hofmann, F., Flockerzi, V., Kahl, S. & Wegener, J. W. L-type CaV1.2 calcium channels: from in vitro findings to in vivo function. Physiol. Rev. 94, 303–326 (2014).
Laurie, D. J. & Seeburg, P. H. Regional and developmental heterogeneity in splicing of the rat brain NMDAR1 mRNA. J. Neurosci. 14, 3180–319 (1994).
Prybylowski, K., Rumbaugh, G., Wolfe, B. B. & Vicini, S. Increased exon 5 expression alters extrasynaptic NMDA receptors in cerebellar neurons. J. Neurochem. 75, 1140–1146 (2000).
Li, Y. I., Sanchez-Pulido, L., Haerty, W. & Ponting, C. P. RBFOX and PTBP1 proteins regulate the alternative splicing of micro-exons in human brain transcripts. Genome Res. 25, 1–13 (2015).
Daminanov, A. & Black, D. L. Autoregulation of Fox protein expression to produce dominant negative splicing factors. RNA 16, 405–416 (2010).
Lovci, M. T. et al. Rbfox proteins regulate alternative mRNA splicing through evolutionarily conserved RNA bridges. Nat. Struct. Mol. Biol. 20, 1434–1442 (2013).
Nakahata, S. & Kawamoto, S. Tissue-dependent isoforms of mammalian Fox-1 homologs are associated with tissue-specific splicing activities. Nucleic Acids Res. 33, 2078–2089 (2005).
Baraniak, A. P., Chen, J. R. & Garcia-Blanco, M. A. Fox-2 mediates epithelial cell-specific fibroblast growth factor receptor 2 exon choice. Mol. Cell Biol. 26(1209-12), 22 (2006).
Huang, S. C. et al. RBFOX2 promotes protein 4.1R exon 16 selection via U1 snRNP recruitment. Mol. Cell. Biol. 32, 513–526 (2012).
Mauger, D. M., Lin, C. & Garcia-Blanco, M. A. hnRNP H and hnRNP F complex with Fox2 to silence fibroblast growth factor receptor 2 exon IIIc. Mol. Cell. Biol. 28, 5403–5419 (2008).
Venables, J. P. et al. Cancer-associated regulation of alternative splicing. Nat. Struct. Mol. Biol. 16, 670–676 (2009).
Guo, L., Han, A., Bates, D. L., Cao, J. & Chen, L. Crystal structure of a conserved N-terminal domain of histone deacetylase 4 reveals functional insights into glutamine-rich domains. Proc. Natl. Acad. Sci. USA 104, 4297–4302 (2007).
Cosker, K. E., Fenstermacher, S. J., Pazyra-Murphy, M. F., Elliott, H. L. & Segal, R. A. The RNA-binding protein SFPQ orchestrates an RNA regulon to promote axon viability. Nat. Neurosci. 19, 690–696 (2016).
Lee, J. A. et al. Cytoplasmic Rbfox1 Regulates the Expression of Synaptic and Autism-Related Genes. Neuron 89, 113–128 (2016).
Ray, D. et al. A compendium of RNA-binding motifs for decoding gene regulation. Nature 499, 172–177 (2013).
Verma, S. K. et al. Rbfox2 function in RNA metabolism is impaired in hypoplastic left heart syndrome patient hearts. Sci Rep. 6, 30896, doi:10.1038/srep30896 (2016).
Karlsson, K. & Linnarsson, S. Single-cell mRNA isoform diversity in the mouse brain. BMC Genomics. 18, 126, doi:10.1186/s12864-017-3528-6 (2017).
Choi, H. J. et al. (2008) Excitatory actions of GABA in the suprachiasmatic nucleus. J. Neurosci. 28, 5450–5459 (2008).
Shinohara, K., Funabashi, T., Nakamura, T. J., Mitsushima, D. & Kimura, F. Differential regulation of pituitary adenylate cyclase-activating peptide receptor variants in the rat suprachiasmatic nucleus. Neuroscience 110, 301–308 (2002).
Shapiro-Reznik, M., Jilg, A., Lerner, H., Earnest, D. J. & Zisapel, N. Diurnal rhythms in neurexins transcripts and inhibitory/excitatory synapse scaffold proteins in the biological clock. PLoS One. 7, e37894, doi:10.1371/journal.pone.0037894 (2012).
Zhang, C. et al. Integrative modeling defines the Nova splicing-regulatory network and its combinatorial controls. Science 329, 439–443 (2010).
Holter, J. L., Humphries, A., Crunelli, V. & Carter, D. A. Optimisation of methods for selecting candidate genes from cDNA array screens: Application to rat brain punches and pineal. J. Neurosci. Methods 112, 173–84 (2001).
Paxinos, G. & Watson, C. The rat brain in stereotaxic coordinates (Elsevier Academic Press, 2005).
Man, P. S., Wells, T. & Carter, D. A. Egr1-d2EGFP transgenic rats identify transient populations of neurons and glial cells during postnatal brain development. Gene Expr. Patterns 7, 872–883 (2007).
Carter, D. A. Molecular phenotyping of transient postnatal tyrosine hydroxylase neurons in the rat bed nucleus of the stria terminalis. J. Chem. Neuroanat. 82, 29–38 (2017).
Schneider, C. A., Rasband, W. S. & Eliceiri, K. W. NIH Image to ImageJ: 25 years of image analysis. Nat. Methods 9, 671–675 (2012).
Zhu, L. J. & Altmann, S. W. mRNA and 18S-RNA coapplication-reverse transcription for quantitative gene expression analysis. Anal. Biochem. 345, 102–109 (2005).
Acknowledgements
This study was supported by the Cardiff School of Biosciences. Professor David Murphy (University of Bristol, UK) is thanked for the gift of PC12 cells.
Author information
Authors and Affiliations
Contributions
D.A.C. conceived the study, and both L.M.M.P. and D.A.C. performed experimental analyses. D.A.C. drafted the paper that has been read and approved by both authors.
Corresponding author
Ethics declarations
Competing Interests
The authors declare that they have no competing interests.
Additional information
Publisher's note: Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.
Electronic supplementary material
Rights and permissions
Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/.
About this article
Cite this article
Partridge, L.M.M., Carter, D.A. Novel Rbfox2 isoforms associated with alternative exon usage in rat cortex and suprachiasmatic nucleus. Sci Rep 7, 9929 (2017). https://doi.org/10.1038/s41598-017-10535-3
Received:
Accepted:
Published:
DOI: https://doi.org/10.1038/s41598-017-10535-3
Comments
By submitting a comment you agree to abide by our Terms and Community Guidelines. If you find something abusive or that does not comply with our terms or guidelines please flag it as inappropriate.